 Friends links |
|
| Picture |
Heading |
Updated |
 |
Soybean meal for animal feed, protein 42-46 pct
Model Number: YT118
Brand Name: yatai
Key Specifications/Special Features:
High quality soybean mealProducts information:Crude protein: 42%minMoisture: ≤10%Crude fat: ≤10%Certificate: PONY SGSStorage: stored in a cool, ventilated and dry placePa... |
2017-12-28 |
 |
High Quality Floating Fish Feed Pellet for Catfish
Model Number: animal feed
Brand Name: yatai
Key Specifications/Special Features:
Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitat... |
2017-10-02 |
 |
2017 wholesale glass feeding baby bottle, 120ml or 240 ml
Model Number: yt-001
Brand Name: yatai
Key Specifications/Special Features:
Key Specifications/Special Features:120.240ml baby bottle, welcome OEMPlastic variety: PP, PE or as requiresQuantitative method: measuring line on the body of the bott... |
2017-09-20 |
|
